Search Result

Results for "

Neuropathic pain

" in MedChemExpress (MCE) Product Catalog:

By Targets:	5-HT Receptor (3) AAK1 (9) Adenosine Receptor (3) Adrenergic Receptor (2) Aminopeptidase (1) Angiotensin Receptor (1) Antibiotic (1) Apoptosis (6) Autophagy (2) Calcium Channel (6) Cannabinoid Receptor (8) CCR (2) CGRP Receptor (1) Cholinesterase (ChE) (2) COX (3) CXCR (3) Cyclin G-associated Kinase (GAK) (2) Dopamine Receptor (1) Epigenetic Reader Domain (1) Epoxide Hydrolase (1) FAAH (3) Fungal (2) GABA Receptor (4) GPR55 (1) HDAC (2) Histamine Receptor (6) HSV (1) iGluR (13) Indoleamine 2,3-Dioxygenase (IDO) (1) Influenza Virus (1) Insulin Receptor (1) Interleukin Related (1) Isotope-Labeled Compounds (2) JAK (1) Lipoxygenase (1) mAChR (2) MAGL (3) Mas-related G-protein-coupled Receptor (MRGPR) (3) MEK (1) mGluR (4) MicroRNA (1) Mitophagy (1) Monoamine Oxidase (1) nAChR (3) Neuropeptide Y Receptor (1) NO Synthase (3) Opioid Receptor (8) P2X Receptor (6) PACAP Receptor (1) PARP (1) Phosphodiesterase (PDE) (2) Potassium Channel (8) SARS-CoV (1) Serotonin Transporter (3) Sigma Receptor (9) Sodium Channel (18) Somatostatin Receptor (1) TNF Receptor (1) Topoisomerase (1) Trk Receptor (1) TRP Channel (10) Wnt (1) β-catenin (1)
By Research Areas:	Cancer (18) Cardiovascular Disease (9) Endocrinology (2) Infection (5) Inflammation/Immunology (30) Metabolic Disease (6) Neurological Disease (135)
Click Chemistry:	Alkynes (1)

153

Inhibitors & Agonists

Peptides

Natural
Products

Isotope-Labeled Compounds

Click Chemistry

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-131004

CB2R PAM	Cannabinoid Receptor	Neurological Disease
CB2R PAM is an orally active cannabinoid type-2 receptors (CB2Rs) positive allosteric modulator. CB2R PAM displays antinociceptive activity in vivo in an experimental mouse model of neuropathic pain .

HY-110036

GW-405833 L768242	Cannabinoid Receptor	Neurological Disease Inflammation/Immunology
GW-405833 (L768242) is a potent, selective cannabinoid receptor 2 (CB₂) agonist with an EC₅₀ of 50.7 nM. GW-405833 also behaves as a noncompetitive CB₁ antagonist. GW-405833 suppresses inflammatory and neuropathic pain .

HY-124382

AS1928370	TRP Channel	Neurological Disease
AS1928370 is a novel and central nervous system (CNS) penetrant TRPV1 antagonist and can prevent ligand-induced activation in vivo. AS1928370 is a promising agent for neuropathic pain treatment research .

HY-113608

VCP171	Adenosine Receptor	Neurological Disease
VCP171 is a potent adenosine A1 receptor (A1R) positive allosteric modulator (PAM). VCP171 is effective at decreasing excitatory synaptic currents in Lamina II of neuropathic pain model. VCP171 can be used for researching neuropathic pain .

HY-12122

AR-C102222	NO Synthase	Neurological Disease
AR-C102222 is a spirocyclic fluoropiperidine quinazoline selective iNOS inhibitor. AR-C102222 can be used for the research of neuropathic pain .

HY-143263

FAAH/MAGL-IN-1	FAAH MAGL	Neurological Disease
FAAH/MAGL-IN-1 (compound SIH 3) is a potent FAAH and MAGL inhibitor with IC₅₀s of 31 nM and 29 nM, respectively. FAAH/MAGL-IN-1 has the potential for the research of neuropathic pain .

HY-14897

Rezatomidine AGN-203818	Adrenergic Receptor	Neurological Disease Metabolic Disease
Rezatomidine (AGN-203818) is a potent and selective α2-AR agonist. Rezatomidine can be used for diabetic neuropathy and neuropathic pain research .

HY-145584

Nesuparib JPI-547/OCN-201	PARP	Cardiovascular Disease Neurological Disease
Nesuparib is a potent inhibitor of PARP. Nesuparib is useful for the research of neuropathic pain, neurodegenerative disease, and cardiovascular disease (extracted from patent WO2016200101A2) .

HY-15451

MDA 19 1 Publications Verification	Cannabinoid Receptor	Neurological Disease
MDA 19 is a potent and selective agonist of human cannabinoid receptor 2 (CB2), with a K_i of 43.3 nM. MDA 19 has antiallodynic effects in a rat model of neuropathic pain and does not affect rat locomotor activity .

HY-B0161E

(±)-Duloxetine hydrochloride (Rac)-Duloxetine hydrochloride	Serotonin Transporter	Neurological Disease
(±)-Duloxetine ((Rac)-Duloxetine) hydrochloride is the racemate of Duloxetine hydrochloride. Duloxetine hydrochloride, a serotonin-norepinephrine reuptake inhibitor, can be used for diabetic neuropathic pain and fibromyalgia as well as major depressive disorder research .

HY-117714

AZD-3161	Sodium Channel	Neurological Disease
AZD-3161 is a potent and selective blocker of Na_V1.7 channel, with a pIC₅₀ of 7.1. AZD-3161 can be used for the research of neuropathic and inflammatory pain .

HY-B0246

Carbamazepine Maximum Cited Publications 10 Publications Verification CBZ; NSC 169864	Sodium Channel Autophagy Mitophagy Potassium Channel Calcium Channel HDAC	Neurological Disease Cancer
Carbamazepine is an orally active pressure-sensitive sodium ion channel blocker with an IC₅₀ of 131 μM. Carbamazepine blocks voltage gated Na ⁺, Ca ²⁺, and K ⁺ channels, and is also a HDAC inhibitor (IC₅₀: 2 μM). Carbamazepine is an anticonvulsant and can be used for research of epilepsy and neuropathic pain .

HY-155616

KSK94	Sigma Receptor Histamine Receptor	Neurological Disease
KSK94 is a high-affinity histamine H3 receptor antagonist, with K_is of 7.9, 2958, 75.2 nM for H3 receptor, sigma-1, sigma-2 receptor respectively. KSK94 can be used for research of nociceptive and neuropathic pain .

HY-P5858

µ-Conotoxin SIIIA	Sodium Channel	Neurological Disease
μ-Conotoxin SIIIA is a tetrodotoxin (TTX)-resistant sodium channel blocker. μ-Conotoxin SIIIA is a toxic peptide that can be obtained from the venom of Conus snails. μ-Conotoxin SIIIA can be used in the study of neurological diseases, such as neuropathic pain .

HY-132133

Nav1.8-IN-1	Sodium Channel	Neurological Disease Inflammation/Immunology
Nav1.8-IN-1 (Compound 31) is a potent inhibitor of Na(v)1.8 sodium channel. Nav1.8-IN-1 has the potential for the research of inflammatory and neuropathic pain .

HY-143879

MRGPRX1 agonist 3	Mas-related G-protein-coupled Receptor (MRGPR)	Neurological Disease
MRGPRX1 agonist 3 (compound 1f) is a potent Mas-related G protein-coupled receptor X1 (MRGPRX1) positive allosteric modulator with an EC₅₀ value of 0.22 μM. MRGPRX1 agonist 3 can be used for researching neuropathic pain .

HY-A0057

Gabapentin 5+ Cited Publications	Calcium Channel	Neurological Disease Cancer
Gabapentin is a potent, orally active P/Q type Ca ²⁺ channel blocker. Gabapentin inhibits neuronal Ca ²⁺ influx and reduction of neurotransmitter release. Gabapentin is a GABA analog that can be used to relieve neuropathic pain .

HY-A0057A

Gabapentin hydrochloride 5+ Cited Publications	Calcium Channel	Neurological Disease Cancer
Gabapentin hydrochloride is a potent, orally active P/Q type Ca ²⁺ channel blocker. Gabapentin hydrochloride inhibits neuronal Ca ²⁺ influx and reduction of neurotransmitter release. Gabapentin hydrochloride is a GABA analog that can be used to relieve neuropathic pain .

HY-155615

KSK67	Sigma Receptor Histamine Receptor	Neurological Disease
KSK67 is a high-affinity dual sigma-2 and histamine H3 receptor antagonist, with K_is of 3.2, 1531, 101 nM for H3 receptor, sigma-1, sigma-2 receptor respectively. KSK67 can be used for research of nociceptive and neuropathic pain .

HY-14900

Tedalinab GRC-10693	Cannabinoid Receptor	Inflammation/Immunology
Tedalinab (GRC-10693) is a potent, orally active, and selective cannabinoid receptor 2 (CB2) agonist. Tedalinab has >4700-fold functional selectivity for CB2 over CB1. Tedalinab has potential for neuropathic pain and osteoarthritis treatment .

HY-143878

MRGPRX1 agonist 2	Mas-related G-protein-coupled Receptor (MRGPR)	Neurological Disease
MRGPRX1 agonist 2 (compound 1a) is a potent Mas-related G protein-coupled receptor X1 (MRGPRX1) positive allosteric modulator with an EC₅₀ value of 0.48 μM. MRGPRX1 agonist 2 can be used for researching neuropathic pain .

HY-129421

PA-9	PACAP Receptor	Neurological Disease Inflammation/Immunology
PA-9 is a pituitary adenylate cyclase-activating polypeptide (PACAP) type I (PAC1) receptor antagonist. PA-9 dose dependently inhibits PACAP-induced cAMP elevation with an IC₅₀ of 5.6 nM. PA-9 can be used for the research of neuropathic and/or inflammatory pain .

HY-15078

NS1219 (R)-SPD502	iGluR	Neurological Disease
NS1219 ((R)-SPD502) is the isomer of NS 1209 HY-15074. NS1209 is a selective AMPA receptor antagonist with neuroprotective activity. NS1209 can be used for the research of stroke, neuropathic pain and epilepsy .

HY-P3431

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-155614

KSK68	Sigma Receptor Histamine Receptor	Neurological Disease
KSK68 is a high-affinity dual sigma-1 and histamine H3 receptor antagonist, with K_is of 7.7, 3.6, 22.4 nM for H3 receptor, sigma-1, sigma-2 receptor respectively. KSK68 has negligible affinity at the other histamine receptor subtypes. KSK68 can be used for research of nociceptive and neuropathic pain .

HY-P3431A

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-143880

MRGPRX1 agonist 4	Mas-related G-protein-coupled Receptor (MRGPR)	Neurological Disease
MRGPRX1 agonist 4 (compound 1t) is a potent and orally active Mas-related G protein-coupled receptor X1 (MRGPRX1) positive allosteric modulator with an EC₅₀ value of 0.1 μM. MRGPRX1 agonist 4 has good metabolic stability and oral bioavailability. MRGPRX1 agonist 4 can reduce behavioral heat hypersensitivity in a neuropathic pain model humanized MRGPRX1 mice. MRGPRX1 agonist 4 can be used for researching neuropathic pain .

HY-144301

AAK1-IN-2	AAK1	Neurological Disease
AAK1-IN-2 (compound (S)-31) is a potent, selective and brain-penetrant inhibitor of Adaptor Protein 2-Associated Kinase 1 (AAK1), with an IC₅₀ of 5.8 nM. AAK1-IN-2 can be used for the research of neuropathic pain .

HY-107656

PTAC oxalate	mAChR	Neurological Disease
PTAC oxalate is a selective muscarinic receptor ligand. PTAC oxalate is an partial agonist of M2 and M4 but antagonist of M1, M3, and M5 (K_i values of 0.2-2.8 nM for hM1-5 in CHO cells). PTAC oxalate alleviates the mechanical allodynia on the neuropathic pain and has antidepression effects .

HY-144301A

AAK1-IN-2 TFA	AAK1	Neurological Disease
AAK1-IN-2 TFA (compound (S)-31) is a potent, selective and brain-penetrant inhibitor of Adaptor Protein 2-Associated Kinase 1 (AAK1), with an IC₅₀ of 5.8 nM. AAK1-IN-2 TFA can be used for the research of neuropathic pain .

HY-108449

Acoltremon WS-12; AR-15512; AVX-012	TRP Channel	Cancer
Acoltremon (WS-12; AR-15512) is a potent and selective TRPM8 agonist, the menthol derivative, as a cooling agent. Acoltremon shows analgesic effect, and can be used in chronic neuropathic pain research .

HY-133130

JNJ-42226314	MAGL	Neurological Disease
JNJ-42226314 is a competitive, highly selective and reversible non-covalent monoacylglycerol lipase (MAGL) inhibitor. JNJ-42226314 demonstrates dose-dependent enhancement of the major endocannabinoid 2-arachidonoylglycerol (2-AG) as well as efficacy in models of neuropathic and inflammatory pain .

HY-P1129

AR-M1896	Neuropeptide Y Receptor	Neurological Disease
AR-M1896 is a GalR2 selective agonist with a binding IC₅₀ of 1.76 nM for rat GalR2. AR-M1896 can be used for the research of acute myocardial infarction and neuropathic pain .

HY-P0244

Dermorphin

Opioid Receptor Neurological Disease

Dermorphin is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain .

Dermorphin	Opioid Receptor	Neurological Disease
Dermorphin is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain .

HY-P0244A

Dermorphin TFA	Opioid Receptor	Neurological Disease
Dermorphin TFA is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain .

HY-118140

ZCZ011	Cannabinoid Receptor	Neurological Disease Inflammation/Immunology
ZCZ011 is a potent and brain penetrant cannabinoid 1 (CB1) receptor positive allosteric modulator. ZCZ011 potentiates binding of CP55,940 to the CB1 receptor, enhances anandamide (AEA)-stimulated GTPγS binding in mouse brain membranes. ZCZ011 increases β-arrestin recruitment and ERK phosphorylation in hCB1 cells. ZCZ011 can be used for researching neuropathic and inflammatory pain .

HY-16935

Mavatrep JNJ-39439335	TRP Channel	Neurological Disease
Mavatrep (JNJ-39439335) is an orally active, selective and potent TRPV1 antagonist with high affinity for hTRPV1 channels (K_i=6.5 nM). Mavatrep antagonizes capsaicin-induced Ca ²⁺ influx with an IC₅₀ value of 4.6 nM. Mavatrep can be used in some studies of neuropathic pain .

HY-P3618

Cortistatin 29	Somatostatin Receptor	Neurological Disease
Cortistatin 29 is a neuropeptide. Cortistatin 29 alleviates neuropathic pain. Cortistatin 29 binds with high affinity all somatostatin (SS) receptor subtypes and shows IC₅₀ values of 2.8, 7.1, 0.2, 3.0, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin 29 shows anti-fibrotic effects .

HY-103461

FAAH-IN-6	FAAH	Neurological Disease
FAAH-IN-6 (compound 21d) is a potent, orally active and cross the blood-brain barrier fatty acid amide hydrolase (FAAH) inhibitor with IC₅₀s of 0.72, 0.28 nM for hFAAH, rFAAH, respectively. FAAH-IN-6 shows dose-dependent analgesic efficacy in animal models of both neuropathic and inflammatory pain .

HY-155183

A3AR agonist 1	Adenosine Receptor	Inflammation/Immunology Cancer
A3AR agonist 1 (Compound 12) is an A3AR agonist (K_i: 25.8 nM). A3AR agonist 1 stimulates β-arrestin2 recruitment, with an EC₅₀ value of 5.17 nM. A3AR agonist 1 can be used for research of inflammatory diseases, ischemia, cancer, neuropathic pain, liver diseases, etc .

HY-143264

FAAH/MAGL-IN-2	FAAH MAGL	Neurological Disease
FAAH/MAGL-IN-2 is a potent, reversible, orally active, and cross the blood-brain barrier FAAH and MAGL inhibitor with IC₅₀s of 11 nM and 36 nM (K_is of 28 nM and 60 nM), respectively . FAAH/MAGL-IN-2 has the potential to research neuropathic pain without causing locomotion impairment .

HY-144302

AAK1-IN-3	AAK1	Neurological Disease
AAK1-IN-3, a quinoline analogue, is a brain-penetrant adaptor protein 2-associated kinase 1 (AAK1) inhibitor with an IC₅₀ of 11 nM. AAK1-IN-3 has the potential for neuropathic pain research .

HY-131019

JF-NP-26	mGluR	Neurological Disease
JF-NP-26, an inactive photocaged derivative of raseglurant, is the first caged mGlu5 receptor negative allosteric modulator. Uncaging of JF-NP-26 is elicited with light pulses in the visible spectrum (405 nm). JF-NP-26 induces light-dependent analgesia in models of inflammatory and neuropathic pain in freely behaving animals .

HY-144302A

AAK1-IN-3 TFA	AAK1	Neurological Disease
AAK1-IN-3 TFA, a quinoline analogue, is a brain-penetrant adaptor protein 2-associated kinase 1 (AAK1) inhibitor with an IC₅₀ of 11 nM. AAK1-IN-3 has the potential for neuropathic pain research .

HY-125111

PSB-SB-487	GPR55 Cannabinoid Receptor	Neurological Disease Metabolic Disease Cancer
PSB-SB-487 is a potent GPR55 antagonist and CB₂ agonist with an IC₅₀ value of 0.113 µM for GPR55, and a K_i value of 0.292 µM for human CB₂. PSB-SB-487 can be used for researching diabetes, Parkinson’s disease, neuropathic pain, and cancer .

HY-103111

MMPIP hydrochloride	mGluR	Neurological Disease
MMPIP hydrochloride is an allosteric metabotropic glutamate receptor 7 (mGluR7) selective antagonist (K_B values 24 -30 nM). MMPIP hydrochloride acts as a pharmacological tool for elucidating the roles of mGluR7 on central nervous system functions. MMPIP hydrochloride alleviates pain and normalizes affective and cognitive behavior in neuropathic mice .

HY-107503

MMPIP	mGluR	Neurological Disease
MMPIP is an allosteric metabotropic glutamate receptor 7 (mGluR7) selective antagonist (K_B values 24 -30 nM). MMPIP acts as a pharmacological tool for elucidating the roles of mGluR7 on central nervous system functions. MMPIP alleviates pain and normalizes affective and cognitive behavior in neuropathic mice .

HY-136459

NMDA receptor antagonist 2	iGluR	Neurological Disease
NMDA receptor antagonist 2 is a potent and orally active NR2B subtype-selective NMDA antagonist with an IC₅₀ and a K_i of 1.0 nM and 0.88 nM, respectively. NMDA receptor antagonist 2 is used for the study of neuropathic pain and Parkinson’s disease .

HY-145838

AAK1-IN-4	AAK1	Neurological Disease
AAK1-IN-4 is a highly selective, CNS-penetrable, and orally active adaptor protein-2-associated kinase 1 (AAK1) inhibitor (AAK1 IC₅₀ of 4.6 nM, Filt K_i of 0.9 nM, and cell IC₅₀ of 8.6 nM). AAK1-IN-4 has the potential for the research for neuropathic pain .

HY-145839

AAK1-IN-5	AAK1	Neurological Disease
AAK1-IN-5 is a highly selective, CNS-penetrable, and orally active adaptor protein-2-associated kinase 1 (AAK1) inhibitor (AAK1 IC₅₀ of 1.2 nM, Filt K_i of 0.05 nM, and cell IC₅₀ of 0.5 nM). AAK1-IN-4 has the potential for the research for neuropathic pain .

Cat. No.	Product Name	Target	Research Area

HY-P0244

Dermorphin

Opioid Receptor Neurological Disease

Dermorphin is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain .

HY-P5858

µ-Conotoxin SIIIA	Sodium Channel	Neurological Disease
μ-Conotoxin SIIIA is a tetrodotoxin (TTX)-resistant sodium channel blocker. μ-Conotoxin SIIIA is a toxic peptide that can be obtained from the venom of Conus snails. μ-Conotoxin SIIIA can be used in the study of neurological diseases, such as neuropathic pain .

HY-P3431

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P3431A

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P1129

AR-M1896	Neuropeptide Y Receptor	Neurological Disease
AR-M1896 is a GalR2 selective agonist with a binding IC₅₀ of 1.76 nM for rat GalR2. AR-M1896 can be used for the research of acute myocardial infarction and neuropathic pain .

HY-P0244A

Dermorphin TFA

Opioid Receptor Neurological Disease

Dermorphin TFA is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain .

HY-P3618

Cortistatin 29	Somatostatin Receptor	Neurological Disease
Cortistatin 29 is a neuropeptide. Cortistatin 29 alleviates neuropathic pain. Cortistatin 29 binds with high affinity all somatostatin (SS) receptor subtypes and shows IC₅₀ values of 2.8, 7.1, 0.2, 3.0, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin 29 shows anti-fibrotic effects .

HY-P1626

Acetyl tetrapeptide-15	Opioid Receptor	Neurological Disease
Acetyl tetrapeptide-15 is a synthetic peptide used in the cosmetics for sensitive skin. Acetyl tetrapeptide-15 is derived from endomorphin-2 (Tyr-Pro-Phe-Phe-NH2), a human μ-opioid agonist with selective anti-nociceptive effect. Acetyl tetrapeptide-15 reduces skin hyperreactivity producing inflammatory, chronic and neuropathic pain, by increasing the threshold of neuronal excitability in μ-opioid receptor via an endorphin-like pathway .

HY-P1267

α-Conotoxin PnIA	nAChR	Neurological Disease
α-Conotoxin PnIA, a potent and selective antagonist of the mammalian α7 nAChR, has the potential for the research of neurological conditions such as neuropathic pain and Alzheimer’s disease .

HY-P1267A

α-Conotoxin PnIA TFA	nAChR	Neurological Disease
α-Conotoxin PnIA TFA, a potent and selective antagonist of the mammalian α7 nAChR, has the potential for the research of neurological conditions such as neuropathic pain and Alzheimer’s disease .

HY-P3223

Biphalin TFA	Opioid Receptor	Neurological Disease
Biphalin TFA, a BBB-penetrable opioid peptide analog, contains two active enkephalin pharmacophores. Biphalin TFA has high affinity for opioid receptors. Biphalin TFA shows analgesic effect in acute, neuropathic, and chronic animal pain models. Biphalin TFA is also an antiviral, antiproliferative, anti-inflammatory, and neuroprotective agent .

HY-P1220

Huwentoxin-IV	Sodium Channel	Neurological Disease
Huwentoxin-IV is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC₅₀s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV has analgesic effects on animal models of inflammatory and neuropathic pain .

HY-P1220A

Huwentoxin-IV TFA	Sodium Channel	Neurological Disease
Huwentoxin-IV TFA is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC₅₀s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV TFA preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV TFA has analgesic effects on animal models of inflammatory and neuropathic pain .

HY-125777A

α-Conotoxin Vc1.1 TFA	nAChR	Neurological Disease
α-Conotoxin Vc1.1 TFA is a disulfide-bonded peptide isolated from Conus victoriae and is a selective nAChR antagonist. α-Conotoxin Vc1.1 TFA inhibits α3α5β2, α3β2 and α3β4 with IC₅₀s of 7.2 μM, 7.3 μM and 4.2 μM, respectively, and has less inhibitory effect on other nAChR subtypes. α-Conotoxin Vc1.1 TFA has the potential for neuropathic pain reserach .

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-P0244

Dermorphin	Structural Classification Natural Products Animals Source classification Phenols Polyphenols	Opioid Receptor
Dermorphin is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain .

HY-N3710

Dehydrocrenatidine Kumujian G; O-Methylpicrasidine I	Alkaloids Simaroubaceae Source classification Pyridine Alkaloids Plants	JAK Apoptosis
Dehydrocrenatidine, a natural alkaloid, is a specific JAK inhibitor. Dehydrocrenatidine inhibits voltage-gated sodium channels and ameliorates mechanic allodia in a rat model of neuropathic pain .

HY-P0244A

Dermorphin TFA	Structural Classification Animals Source classification Phenols Polyphenols	Opioid Receptor
Dermorphin TFA is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain .

HY-N2573

Corydalmine L-Corydalmine; TLZ-16	Alkaloids Monophenols Corydalis yanhusuo W. T. Wang Source classification Phenols Plants Isoquinoline Alkaloids Papaveraceae	Fungal CXCR
Corydalmine (L-Corydalmine) inhibits spore germination of some plant pathogenic as well as saprophytic fungi . Corydalmine acts as an oral analgesic agent, exhibiting potent analgesic activity . Corydalmine alleviates Vincristine-induced neuropathic pain in mice by inhibiting an NF-κB-dependent CXCL1/CXCR2 signaling pathway .

HY-W028263

6-Hydroxyflavanone	Structural Classification Flavonoids Flavonones Source classification Muntingia calabura L. Plants Muntingiaceae	COX Opioid Receptor GABA Receptor Lipoxygenase
6-Hydroxyflavanone is a compound that can be isolated from the Muntingia calabura leaves. 6-Hydroxyflavanone targets cyclooxygenase-2 (COX-2), 5-lipoxygenase (5-LOX), and opioid and GABA-A receptors that has anti-inflammatory and anti-neuropathic pain potential. 6-Hydroxyflavanone can be used for the research of diabetes .

HY-N0478

Neoline 1 Publications Verification Bullatine B	Alkaloids Piperidine Alkaloids Structural Classification other families Source classification Plants	Others
Neoline (Bullatine B)) is the active ingredient of the active ingredient (PA), which can be used to cure the disease. Neoline Flow Suppression Nav1.7 Electrical Flow Control (VGSC)，Improve diabetes mechanical pain sensitivity. Neoline has a list of compounds that can be used, research on its use, and the quality of its processing during processing in pain.

HY-N6967

Levomenol (-)-α-Bisabolol	Structural Classification other families Terpenoids Sesquiterpenes Source classification Plants	Apoptosis
Levomenol ((-)-α-Bisabolol), a monocyclic sesquiterpene alcohol, exerts antioxidant, anti-inflammatory, and anti-apoptotic activities. Levomenol also has neuroprotective effects and prevents neuronal damage and memory deficits through reduction of proinflammatory markers induced by permanent focal cerebral ischemia in mice. Levomenol attenuates nociceptive behaviour and central sensitisation in a rodent model of trigeminal neuropathic pain. Orally active .

HY-N0405

Orientin 2 Publications Verification	Structural Classification Flavonoids other families Flavones Source classification Phenols Polyphenols Plants	TNF Receptor Interleukin Related
Orientin is a neuroprotective agentinhibits which has anti-inflammation, anti-oxidative, anti-tumor, and cardio protection properties. Orientin inhibits the levels of IL-6, IL-1β and TNF-α. Orientin increases IL-10 level. Orientin exhibits neuroprotective effect by inhibits TLR4 and NF-kappa B signaling pathway. Orientin can used in study neuropathic pain .

HY-17387

(-)-Huperzine A 3 Publications Verification Huperzine A	Structural Classification Neurological Disease Classification of Application Fields Anti-aging Huperziaceae Source classification Pyridine Alkaloids Plants Alkaloids Terpenoids Sesquiterpenes Huperzia serrata Disease Research Fields	Cholinesterase (ChE) Apoptosis iGluR
(-)-Huperzine A (Huperzine A) is an alkaloid isolated from Huperzia serrata, with neuroprotective activity. (-)-Huperzine A is a potent, highly specific, reversible and blood-brain barrier penetrant inhibitor of acetylcholinesterase (AChE), with an IC₅₀ of 82 nM. (-)-Huperzine A also is non-competitive antagonist of N-methyl-D-aspartate glutamate (NMDA) receptor. (-)-Huperzine A is developed for the research of neurodegenerative diseases, including Alzheimer’s disease .

Cat. No.	Product Name	Chemical Structure

HY-B0563BS

Ropivacaine-d7 hydrochloride

Ropivacaine-d₇ hydrochloride is a deuterium labeled Ropivacaine (hydrochloride) (HY-B0563B) . Ropivacaine hydrochloride is a potent?sodium channel?blocker and blocks impulse conduction via reversible inhibition of?sodium ion influx?in nerve fibrese . Ropivacaine is also an inhibitor of K_2P (two-pore domain potassium channel) TREK-1 with an IC₅₀ of 402.7 μM in COS-7 cell's membrane . Ropivacaine is widely used for neuropathic pain?management in vivo .

HY-A0057S

Gabapentin-d4
Gabapentin-d₄ is the deuterium labeled Gabapentin. Gabapentin (Neurontin) is a pharmaceutical agent, specifically a GABA analog. It was originally developed to treat epilepsy, and currently is also used to relieve neuropathic pain.

HY-B0563S1

Ropivacaine-d7

Ropivacaine-d₇ is deuterium labeled Ropivacaine. Ropivacain is a potent sodium channel blocker. Ropivacain blocks impulse conduction via reversible inhibition of sodium ion influx in nerve fibrese[1][2]. Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane[3]. Ropivacaine is used for the research of neuropathic pain management[1].

HY-B0161ES

(±)-Duloxetine-d3 hydrochloride
(±)-Duloxetine-d₃ (hydrochloride) is deuterium labeled (±)-Duloxetine (hydrochloride). (±)-Duloxetine ((Rac)-Duloxetine) hydrochloride is the racemate of Duloxetine hydrochloride. Duloxetine hydrochloride, a serotonin-norepinephrine reuptake inhibitor, can be used for diabetic neuropathic pain and fibromyalgia as well as major depressive disorder research[1].

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks